ACTR3 monoclonal antibody (M02), clone 2B6

• Catalog Number: orb2291621
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ACTR3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B6
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ACTR3 (AAH44590, 1 a.a. ~ 418 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIAEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
• NCBI: AAH44590
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACTR3 monoclonal antibody (M02), clone 2B6 Western Blot analysis of ACTR3 expression in A-431.

Detection limit for recombinant GST tagged ACTR3 is 10 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ACTR3 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to ACTR3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 6 ug/ml]

Western Blot detection against Immunogen (71.72 KDa).