You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291621 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant ACTR3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ACTR3 (AAH44590, 1 a.a. ~ 418 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIAEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 2B6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH44590 |
ACTR3 monoclonal antibody (M02), clone 2B6 Western Blot analysis of ACTR3 expression in A-431.
Detection limit for recombinant GST tagged ACTR3 is 10 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ACTR3 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to ACTR3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 6 ug/ml]
Western Blot detection against Immunogen (71.72 KDa).