ACTN3 Antibody

• Catalog Number: orb381028
• Category: Antibodies
• Description: ACTN3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, RatFlow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 103241 MW
• UniProt ID: Q08043
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Alpha-actinin-3;Alpha-actinin skeletal muscle isof
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of WISH cells using anti-ACTN3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of ACTN3/Alpha Actinin 3 using anti-ACTN3/Alpha Actinin 3 antibody.Lane 1:human HT1080 cell; 2:rat skeletal muscle tissue; 3:rat skeletal muscle tissue; 4:mouse skeletal muscle tissue; 5:mouse skeletal muscle tissue.

IHC analysis of ACTN3/Alpha Actinin 3 using anti-ACTN3/Alpha Actinin 3 antibody.ACTN3/Alpha Actinin 3 was detected in paraffin-embedded section of mouse skeletal muscle tissues.

IHC analysis of ACTN3/Alpha Actinin 3 using anti-ACTN3/Alpha Actinin 3 antibody.ACTN3/Alpha Actinin 3 was detected in paraffin-embedded section of rat skeletal muscle tissues.

IHC analysis of ACTN3/Alpha Actinin 3 using anti-ACTN3/Alpha Actinin 3 antibody.ACTN3/Alpha Actinin 3 was detected in paraffin-embedded section of human lung cancer tissues.