You have no items in your shopping cart.
Cart summary
ACTL8 Protein, Human, Recombinant (E. coli, His & Myc)
Catalog Number: orb1979028
| Catalog Number | orb1979028 |
|---|---|
| Category | Proteins |
| Description | ACTL8 Protein, Human, Recombinant (E. coli, His & Myc) is expressed in E. coli expression system with N-6xHis and C-Myc tag. The predicted molecular weight is 46.9 kDa and the accession number is Q9H568. |
| Tag | N-6xHis, C-Myc |
| Purity | 98.00% |
| MW | 46.9 kDa (predicted) |
| UniProt ID | Q9H568 |
| Protein Sequence | MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | ACTL8 Protein, Human, Recombinant (E. coli, His & Myc) is expressed in E. coli expression system with N-6xHis and C-Myc tag. The predicted molecular weight is 46.9 kDa and the accession number is Q9H568. |
| Expression Region | 1-366 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
