You have no items in your shopping cart.
Cart summary
ACTA1 Peptide - C-terminal region
Catalog Number: orb2011917
| Catalog Number | orb2011917 |
|---|---|
| Category | Proteins |
| Description | ACTA1 Peptide - C-terminal region |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 42kDa |
| UniProt ID | P68133 |
| Protein Sequence | STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHR |
| NCBI | NP_001091 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | ACTA, ASMA, CFTD, CFTD1, CFTDM, MPFD, NEM1, NEM2, Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with ACTA1 Rabbit Polyclonal Antibody (orb584854). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
