ACSL5 monoclonal antibody (M01), clone 5H8

• Catalog Number: orb2291117
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ACSL5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5H8
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ACSL5 (NP_057318, 91 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS
• NCBI: NP_057318
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACSL5 monoclonal antibody (M01), clone 5H8 Western Blot analysis of ACSL5 expression in HepG2.

Detection limit for recombinant GST tagged ACSL5 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Immunoprecipitation of ACSL5 transfected lysate using anti-ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 MaxPab rabbit polyclonal antibody.

Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody (M01), clone 5H8. Lane 1: ACSL5 transfected lysate(82.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.3 KDa).