ACP1 monoclonal antibody (M06), clone 2A3

• Catalog Number: orb2296461
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant ACP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A3
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG
• Immunogen: ACP1 (AAH07422, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
• NCBI: AAH07422
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in HepG2.

ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in NIH/3T3.

ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in PC-12.

ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in Raw 264.7.

Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody (M06), clone 2A3. Lane 1: ACP1 transfected lysate(18 KDa). Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged ACP1 is 3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (43.12 KDa).