You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296471 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ACO1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2C1 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | ACO1 (AAH18103, 780 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK |
NCBI | AAH18103 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of ACO1 transfected lysate using anti-ACO1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACO1 MaxPab rabbit polyclonal antibody.
Detection limit for recombinant GST tagged ACO1 is approximately 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa).