Cart summary

You have no items in your shopping cart.

    Acetyl Coenzyme A Carboxylase/ACACB Antibody

    Catalog Number: orb614093

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb614093
    CategoryAntibodies
    DescriptionAcetyl Coenzyme A Carboxylase/ACACB Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.25-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat Flow Cytometry, 1-3μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW277 kDa
    UniProt IDO00763
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesAcetyl-CoA carboxylase 2; ACC-beta; Biotin carboxy
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Acetyl Coenzyme A Carboxylase/ACACB Antibody

    Flow Cytometry analysis of HL-60 cells using anti-ACACB antibody(Blue line).The cells were blocked with 10% normal goat serum.And then incubated with rabbit anti-ACACB

    Acetyl Coenzyme A Carboxylase/ACACB Antibody

    IHC analysis of ACACB using anti-ACACB antibody.

    Acetyl Coenzyme A Carboxylase/ACACB Antibody

    WB analysis using anti-ACACB antibody.Lane 1:rat skeletal muscle tissue, Lane 2:mouse skeletal muscle tissue

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars