ACBD3 monoclonal antibody (M01), clone 2G2

• Catalog Number: orb2290860
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ACBD3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G2
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
• NCBI: NP_073572
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACBD3 monoclonal antibody (M01), clone 2G2 Western Blot analysis of ACBD3 expression in HeLa.

ACBD3 monoclonal antibody (M01), clone 2G2. Western Blot analysis of ACBD3 expression in NIH/3T3.

ACBD3 monoclonal antibody (M01), clone 2G2. Western Blot analysis of ACBD3 expression in PC-12.

ACBD3 monoclonal antibody (M01), clone 2G2. Western Blot analysis of ACBD3 expression in Raw 264.7.

Detection limit for recombinant GST tagged ACBD3 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to ACBD3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Western Blot analysis of ACBD3 expression in transfected 293T cell line by ACBD3 monoclonal antibody (M01), clone 2G2. Lane 1: ACBD3 transfected lysate(60.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).