ACADVL monoclonal antibody (M01), clone 5D3

• Catalog Number: orb2296486
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ACADVL.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ACADVL (NP_000009, 345 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 5D3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000009

ACADVL monoclonal antibody (M01), clone 5D3 Western Blot analysis of ACADVL expression in Hela S3 NE.

Immunoperoxidase of monoclonal antibody to ACADVL on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]

Detection limit for recombinant GST tagged ACADVL is approximately 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (35.64 KDa).