ACAA2 monoclonal antibody (M01), clone 5C4

• Catalog Number: orb2291567
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ACAA2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5C4
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ACAA2 (NP_006102, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV
• NCBI: NP_006102
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACAA2 monoclonal antibody (M01), clone 5C4 Western Blot analysis of ACAA2 expression in HeLa.

Detection limit for recombinant GST tagged ACAA2 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ACAA2 on HeLa cell. [antibody concentration 40 ug/ml]

Immunoperoxidase of monoclonal antibody to ACAA2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (37.84 KDa).