ACAA1 monoclonal antibody (M01), clone 3F11

• Catalog Number: orb2296500
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ACAA1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F11
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: ACAA1 (NP_001598, 217 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPD
• NCBI: NP_001598
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in human liver.

ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in PC-12.

ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in A-431.

Western Blot analysis of ACAA1 expression in transfected 293T cell line by ACAA1 monoclonal antibody (M01), clone 3F11. Lane 1: ACAA1 transfected lysate (Predicted MW: 44.3 KDa). Lane 2: Non-transfected lysate.

Immunoperoxidase of monoclonal antibody to ACAA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]

Detection limit for recombinant GST tagged ACAA1 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ACAA1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (36.63 KDa).