Abrin-a Protein, Abrus precatorius, Recombinant (Yeast, His)

• Catalog Number: orb1979897
• Category: Proteins
• Description: The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis. Abrin-a Protein, Abrus precatorius, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 30.1 kDa and the accession number is P11140.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 30.1 kDa (predicted)
• UniProt ID: P11140
• Protein Sequence: QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN
• Expression System: P. pastoris (Yeast)
• Biological Origin: Abrus precatorius
• Biological Activity: The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis. Abrin-a Protein, Abrus precatorius, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 30.1 kDa and the accession number is P11140.
• Expression Region: 1-251 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.