ABP1/AOC1 Antibody

• Catalog Number: orb381042
• Category: Antibodies
• Description: ABP1/AOC1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human, Monkey
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Monkey Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 85378 MW
• UniProt ID: P19801
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Amiloride-sensitive amine oxidase [copper-containi
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody.Lane 1:human 293T cell; 2:human HK-2 cell; 3:monkey COS-7 cell.

IF analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody. ABP1/AOC1 was detected in an immunocytochemical section of T-47D cells.

IHC analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody. ABP1/AOC1 was detected in a paraffin-embedded section of human colonic adenoma tissue.

IHC analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody. ABP1/AOC1 was detected in a paraffin-embedded section of human placenta tissue.

IHC analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody. ABP1/AOC1 was detected in a paraffin-embedded section of human renal cell carcinoma tissue.