ABL2 monoclonal antibody (M09), clone 5C6

• Catalog Number: orb2296507
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ABL2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG3 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 5C6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH65912

ABL2 monoclonal antibody (M09), clone 5C6 Western Blot analysis of ABL2 expression in K-562.

Immunoperoxidase of monoclonal antibody to ABL2 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.5 ug/ml]

Detection limit for recombinant GST tagged ABL2 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ABL2 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (36.41 KDa).