ABCF1 monoclonal antibody (M01), clone 1B4

• Catalog Number: orb2296517
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ABCF1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B4
• Tested applications: ELISA, IF
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ABCF1 (NP_001081, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES
• NCBI: NP_001081
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ABCF1 is 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ABCF1 on HeLa cell. [antibody concentration 10 ug/ml]