You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389437 |
---|---|
Category | Antibodies |
Description | ABCA4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890-1927aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR), different from the related mouse sequence by eight amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 255944 MW |
UniProt ID | P78363 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Retinal-specific ATP-binding cassette transporter; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of ABCA4 using anti-ABCA4 antibody.Lane 1:rat eye tissue;2:mouse eye tissue.
WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating