You have no items in your shopping cart.
Cart summary
AAK1 Peptide - C-terminal region
Catalog Number: orb2011963
| Catalog Number | orb2011963 |
|---|---|
| Category | Proteins |
| Description | AAK1 Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | SGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARS |
| UniProt ID | Q2M2I8 |
| MW | 104kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | DKFZp686F03202, DKFZp686K16132, FLJ23712, FLJ25931 Read more... |
| Note | For research use only |
| NCBI | NP_055726 |
