You have no items in your shopping cart.
Cart summary
2-Cys Prx A Protein, Arabidopsis thaliana, Recombinant (His)
Catalog Number: orb1979838
| Catalog Number | orb1979838 |
|---|---|
| Category | Proteins |
| Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. 2-Cys Prx A Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 24.4 kDa and the accession number is Q96291. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 24.4 kDa (predicted) |
| UniProt ID | Q96291 |
| Protein Sequence | KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Arabidopsis thaliana |
| Biological Activity | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. 2-Cys Prx A Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 24.4 kDa and the accession number is Q96291. |
| Expression Region | 66-266 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
