Cart summary

You have no items in your shopping cart.

    14-3-3 zeta/delta/YWHAZ Antibody

    Catalog Number: orb413035

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb413035
    CategoryAntibodies
    Description14-3-3 zeta/delta/YWHAZ Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsICC, IF, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW28 kDa
    UniProt IDP63104
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative names14-3-3 protein zeta/delta; Protein kinase C inhibi
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    14-3-3 zeta/delta/YWHAZ Antibody

    Flow Cytometry analysis of A431 cells using anti-YWHAZ antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    14-3-3 zeta/delta/YWHAZ Antibody

    Flow Cytometry analysis of U20S cells using anti-YWHAZ antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    14-3-3 zeta/delta/YWHAZ Antibody

    WB analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human HepG2 cell;4:human A549 cell;5:human PANC-1 cell;6:human SK-OV-3 cell;7:human 22RV1 cell.

    14-3-3 zeta/delta/YWHAZ Antibody

    WB analysis using anti-14-3-3 zeta/delta antibody.Lane 1:rat brain tissue;2:rat spleen tissue;3:rat lung tissue;4:rat liver tissue;5:mouse brain tissue;6:mouse spleen tissue;7:mouse lung tissue;8:mouse liver tissue;9:mouse kidney tissue.

    14-3-3 zeta/delta/YWHAZ Antibody

    IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in immunocytochemical section of A431 cell.

    14-3-3 zeta/delta/YWHAZ Antibody

    IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in immunocytochemical section of A549 cell.

    14-3-3 zeta/delta/YWHAZ Antibody

    IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of human lung cancer tissue.

    14-3-3 zeta/delta/YWHAZ Antibody

    IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of human mammary cancer tissue.

    14-3-3 zeta/delta/YWHAZ Antibody

    IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of rat kidney tissue.

    14-3-3 zeta/delta/YWHAZ Antibody

    IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of rat small intestine tissue.

    14-3-3 zeta/delta/YWHAZ Antibody

    IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of mouse small intestine tissues.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars