14-3-3 zeta/delta/YWHAZ Antibody

• Catalog Number: orb413035
• Category: Antibodies
• Description: 14-3-3 zeta/delta/YWHAZ Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunocytochemistry/Immunofluorescence, 5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 28 kDa
• UniProt ID: P63104
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: 14-3-3 protein zeta/delta; Protein kinase C inhibi
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-YWHAZ antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of U20S cells using anti-YWHAZ antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human HepG2 cell;4:human A549 cell;5:human PANC-1 cell;6:human SK-OV-3 cell;7:human 22RV1 cell.

WB analysis using anti-14-3-3 zeta/delta antibody.Lane 1:rat brain tissue;2:rat spleen tissue;3:rat lung tissue;4:rat liver tissue;5:mouse brain tissue;6:mouse spleen tissue;7:mouse lung tissue;8:mouse liver tissue;9:mouse kidney tissue.

IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in immunocytochemical section of A431 cell.

IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in immunocytochemical section of A549 cell.

IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of rat kidney tissue.

IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of rat small intestine tissue.

IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of mouse small intestine tissues.