You have no items in your shopping cart.
Cart summary
14-3-3 zeta/delta Protein, Human, Recombinant (His)
Catalog Number: orb2646423
| Catalog Number | orb2646423 |
|---|---|
| Category | Proteins |
| Description | 14-3-3 zeta/delta Protein, Human, Recombinant (His) is expressed in yeast. The accession number is P63104. |
| Tag | C-6xHis |
| CAS Number | TMPH-03772 |
| Purity | 94.00% |
| MW | 20.6 kDa (predicted) |
| UniProt ID | P63104 |
| Protein Sequence | AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Expression Region | 1-245 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
