RECENTLY VIEWED
Compare Products

You have no items to compare.

 

You're currently on:

Neuropeptide Y peptide

Datasheet
Size Price Availability Qty
0.5 mg
$357
Usually dispatched within 5-10 working days
1 mg
$425
Usually dispatched within 5-10 working days
Shipping charges : Freight/Packing: $34

0 0 antibody to Neuropeptide Y peptide

Product Information

Product name Neuropeptide Y peptide
Catalog Number orb73040
Category Peptides
Conjugation Unconjugated
Tested applications ESI-MS, HPLC
Storage Aliquot and store at -20 °C, avoid repeated freeze/thaw cycles.
Sequence Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (1-36)
Note For research use only.
Target Neuropeptide Y peptide
Alternative names
C-flanking peptide of NPY peptide, CPON peptide, Neuropeptide tyrosine peptide, Neuropeptide Y precursor peptide, NPY peptide, Pro neuropeptide Y peptide, PYY 4 peptide, PYY-4 peptide, PYY4 peptide, Y Neuropeptide peptide

Neuropeptide Y peptide Documents

No document downloads available for this product

Neuropeptide Y peptide Related Products

Name Price  
No related items to display

Neuropeptide Y peptide Customer Reviews

This product has not yet been reviewed. Be the first by entering your review below:


Write Your Own Review

How do you rate this product?*
1 star 2 stars 3 stars 4 stars 5 stars
 
 
 
We use cookies to provide you with a better service. Carry on browsing if you're happy with this, or find out how to manage cookies