Tmed1 Rabbit Polyclonal Antibody

• Catalog Number: orb579880
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tmed1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: Tmed1
• UniProt ID: Q5BK85
• Protein Sequence: Synthetic peptide located within the following region: EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF
• NCBI: NP_001013450
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Il1rl1l
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1 and 2: 30 ug HEK-293 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Tmed1.

Rabbit Anti-Tmed1 Antibody, Catalog Number: orb579880, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic (resembles Golgi), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-Tmed1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-Tmed1 antibody Titration: 1 ug/ml, Sample Type: Human liver.

WB Suggested Anti-Tmed1 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Lung.