TMED1 Rabbit Polyclonal Antibody

• Catalog Number: orb579879
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMED1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMED1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 23kDa
• Target: TMED1
• UniProt ID: Q13445
• Protein Sequence: Synthetic peptide located within the following region: FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF
• NCBI: NP_006849
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Tp24, p24g1, Il1rl1l, IL1RL1LG
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-TMED1 Antibody, Catalog Number: orb579879, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-TMED1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. TMED1 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-TMED1 antibody Titration: 1 ug/ml, Sample Type: Human liver.