RUNX2 Rabbit Polyclonal Antibody

• Catalog Number: orb576068
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RUNX2
• Target: RUNX2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RUNX2
• Protein Sequence: Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM
• UniProt ID: Q13950
• MW: 57kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA,
• Note: For research use only
• NCBI: NP_001019801

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 0.2 ug/ml.

WB Suggested Anti-RUNX2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.