Runx2 Rabbit Polyclonal Antibody

• Catalog Number: orb573718
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Runx2
• Target: Runx2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Protein Sequence: Synthetic peptide located within the following region: PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
• UniProt ID: Q9Z2J9
• MW: 57 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Cbfa1, OSF-2
• Note: For research use only
• NCBI: NP_445922

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Mouse and rat have 66 kDa, 65 kDa, 57 kDa and 51 kDa isoforms that contain this peptide sequence.

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Two isoforms are present at ~70 kDa and ~54 kDa, peptide is present in several predicted isoforms for both Mouse and Rat.

WB Suggested Anti-Runx2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Rat Liver.