You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
REV1 Rabbit Polyclonal Antibody
Catalog Number: orb327223
| Catalog Number | orb327223 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to REV1 |
| Target | REV1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human REV1 |
| Protein Sequence | Synthetic peptide located within the following region: INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA |
| UniProt ID | Q9UBZ9 |
| MW | 138 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti REV1 antibody, anti REV1L antibody, anti anti Read more... |
| Note | For research use only |
| NCBI | XP_005264024 |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 83 and 80 kDa.
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 1
