RecombinantIFN-γ,Rat(CHO-expressed)

SKU: orb1494724

Description

Interferon-γ (IFN-γ), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and sets off IFN-γ/JAK/STAT pathway. IFN-γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.

Images & Validation

• Application Notes:
  Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

• Source: CHO
• Biological Activity: ED50 4×10ˆ5 units/mg.
• Molecular Weight: 15-25 kDa, observed by non-reducing SDS-PAGE.
• Protein Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITN FFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
• Purification: > 95% as analyzed by SDS-PAGE and HPLC.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.

Storage & Handling

• Storage: Lyophilized recombinant Rat Interferon gamma (IFN-γ) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrIFN-γ should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Disclaimer: For research use only

Alternative Names

Immune Interferon, type II interferon, T cell interferon, MAF, IFNG, IFG, IFI,IFN-gamma, IFNγ