NSP16 (SARS-CoV-2) Antibody

SKU: orb1463315

Description

Nsp16 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural protein has methyltransferase activity playing an essential role in viral mRNAs cap methylation which is essential to evade immune system.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:500-1:2,000
• Reactivity: Virus
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Affinity purified recombinant fusion protein using the N-terminal of Nsp16 (residues 1 to 140) and produced in E. coli.. Antigen Sequence: MSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNV
• Target: NSP16 (SARS-CoV-2)
• Purification: Epitope affinity purified

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

methyltransferase, Nsp16 SARS Coronavirus-2 antibody.

Quick Database Links

Gene Symbol

NSP16 (SARS-CoV-2)