You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Lgmn protein
Catalog Number: orb383368
Product Properties
| Catalog Number | orb383368 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Lgmn protein. |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid |
| Buffer/Preservatives | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTN |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | O89017 |
| MW | 38.8 kDa |
| Application notes | E.coli and Yeast N-terminal 6xHis-tagged Full Length |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 18-325aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Asparaginyl endopeptidase Protease, cysteine 1 |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Images
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Similar Products
- Item 1 of 1
- Item 1 of 1
Mouse Lgmn protein [orb383362]
Greater than 90% as determined by SDS-PAGE.
36.8 kDa
Yeast
1 mg, 20 μg, 100 μg 
Recombinant Mouse LGMN/Legumain Protein, N-His [orb2964826]
>90% as determined by SDS-PAGE.
51.42 kDa
1 mg, 100 μg, 50 μgMouse LGMN protein [orb392078]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgMouse LGMN Protein, His Tag [orb2699470]
>75%, determined by SDS-PAGE
This protein contains (Val 18-Tyr 435) of mouse LGMN (NP_0353051) precursor was expressed with a C-terminal polyhistidine tag and expressed from HEK293 Cells.
50 μg, 10 μg
Reviews
Mouse Lgmn protein (orb383368)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review