You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594831 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-13(Il13),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
Protein Length | Partial |
UniProt ID | P20109 |
MW | 11.7 kDa |
Application notes | Partial |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 1.93 ng/ml. |
Expression Region | 26-131aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Interleukin-13; IL-13; T-Cell Activation Protein P Read more... |
Background | Mouse interleukin 13 (mIL-13) is a pleiotropic cyt Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
12.3 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
13.1 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
12.7 kDa | |
Mammalian cell |
Greater than 85% as determined by SDS-PAGE. | |
19.9 kDa | |
E.coli |