You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594830 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-13(Il13),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 12.7 kDa |
UniProt ID | P20109 |
Protein Sequence | SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 2-13 ng/ml. |
Expression Region | 26-131aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | Interleukin-13; IL-13; T-Cell Activation Protein P Read more... |
Background | Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Rα1 with low affinity and triggers association of IL4Rα, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Rα2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disea |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
12.3 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
13.1 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
11.7 kDa | |
E.coli |
Unconjugated | |
90% | |
14.2 kDa | |
Mouse IL-13, His Tag (orb1176550) is expressed from human 293 cells (HEK293). It contains AA Ala 19 - Phe 131 (Accession # P20109-1). |