LGR5 Rabbit Polyclonal Antibody

SKU: orb584402

Description

Rabbit polyclonal antibody to LGR5

Images & Validation

−

Item 1 of 2

Tested Applications	IHC
Predicted Reactivity	Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Target	LGR5
Molecular Weight	100 kDa
Purification	Affinity Purified

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Disclaimer	For research use only

Alternative Names

−

FEX, HG38, GPR49, GPR67, GRP49

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Anti-LGR5 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.

Sample Tissue: Human Liver Tumor, Antibody dilution: 0.5 ug/ml.

Quick Database Links

Gene Symbol

LGR5

UniProt

O75473

RefSeq (Protein):NP_003658

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_003658

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

IHC

Immunohistochemistry

View Protocol

Find More Protocols