You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594800 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-17F(IL17F) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ |
Protein Length | Full Length of Mature Protein |
UniProt ID | AAH70124.1 |
MW | 15.96 kDa |
Application notes | Full Length of Mature Protein |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17RA-Fc at 1μg/ml can bind Human IL-17F-His, the ED50 of Human IL-17F-His is 47.94 ng/ml. |
Expression Region | 31-163aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Interleukin-17F; IL-17F; Cytokine ML-1; Interleuki Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 95% as determined by SDS-PAGE and HPLC. | |
15 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
14.9 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
15.1kDa & 16.0 kDa | |
Mammalian cell |
Greater than 85% as determined by SDS-PAGE. | |
50.1 kDa | |
E.coli |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 15.7 kDa after removal of the signal peptide. The apparent molecular mass of His-IL17F is approximately 15-25 kDa due to glycosylation. | |
Mammalian |