You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL-23 protein
Catalog Number: orb594820
| Catalog Number | orb594820 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-23(IL-23) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Protein Length | Heterodimer |
| UniProt ID | P29460, Q9NPF7 |
| MW | 54.4 kDa |
| Application notes | Heterodimer |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to induce STAT reporter activity in 293F human embryonic kidney cells is 70-210 ng/ml. |
| Expression Region | 20-189aa & 23-328aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | SGRF;IL-23p19;CLMF p40;IL-12 subunit p40;NKSF2 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
- Item 1 of 1
- Item 1 of 3
Recombinant human IL-23 R protein, C-mFc (HEK293) [orb1516407]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 80-115 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 3
Recombinant human IL-23 Alpha & mouse IL-12 Beta protein, C-His-Avi (HEK293) [orb1516411]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 50-60 (Mouse IL12 Beta) & 22 ( Human IL23 Alpha) kDa based on Tris-Bis PAGE result.
20 μg - Item 1 of 1
Human IL23R protein [orb594791]
Greater than 90% as determined by SDS-PAGE.
65 kDa
Mammalian cell
500 μg, 10 μg, 1 mg, 50 μg
