You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CA8 protein
Catalog Number: orb594896
| Catalog Number | orb594896 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Carbonic anhydrase-related protein(CA8),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 34.04 kDa |
| UniProt ID | P35219 |
| Protein Sequence | ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The esterase activity is determined to be is 162.5 pmol/min/μg. |
| Expression Region | 2-290aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | 0.2 μm filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5 |
| Alternative names | Carbonic Anhydrase-Related Protein; CARP; Carbonic Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
- Item 1 of 1
Human CA8 protein [orb54284]
Greater than 90% as determined by SDS-PAGE.
60 kDa
E.coli
20 μg, 1 mg, 100 μg 
Human CA8 protein [orb391340]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg
