You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290043 |
---|---|
Category | Proteins |
Description | Human CA8 full-length ORF ( NP_004047.3, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
Clonality | Recombinant |
Tested applications | AP, Array, ELISA, WB |
Tag | GST |
Antibody Type | Recombinant Antibody |
Protein Sequence | MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ |
NCBI | NP_004047.3 |
Storage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Buffer/Preservatives | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Note | For research use only |
Application notes | Best use within three months from the date of receipt of this protein. |
Expiration Date | 6 months from date of receipt. |