You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human ACVR2B protein
Catalog Number: orb604918
| Catalog Number | orb604918 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Activin receptor type-2B(ACVR2B),partial |
| Tag | N-terminal 6xHis-B2M-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT |
| Protein Length | Extracellular Domain |
| UniProt ID | Q13705 |
| MW | 27.7 kDa |
| Application notes | Extracellular Domain |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 19-137aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Activin receptor type IIB Short name, ACTR-IIB |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human ACVR2B protein [orb358334]
Greater than 90% as determined by SDS-PAGE.
15.7 kDa
Yeast
20 μg, 100 μg, 1 mg - Item 1 of 1
Human ACVR2B protein [orb594924]
Greater than 95% as determined by SDS-PAGE.
41.3 kDa
Mammalian cell
50 μg, 10 μg, 1 mg, 500 μg - Item 1 of 1
Mouse ACVR2B Protein, hFc Tag [orb2321223]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.8 kDa after removal of the signal peptide. The apparent molecular mass of mACVR2B-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human ACVR2B Protein, mFc Tag [orb2321461]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.9 kDa after removal of the signal peptide. The apparent molecular mass of ACVR2B-mFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human ACVR2B Protein, hFc Tag [orb2321328]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.8 kDa after removal of the signal peptide. The apparent molecular mass of ACVR2B-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
