You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578003 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNB1L |
Target | GNB1L |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GNB1L |
Protein Sequence | Synthetic peptide located within the following region: RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA |
UniProt ID | Q9BYB4 |
MW | 36kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | GY2, FKSG1, WDR14, WDVCF, DGCRK3 |
Note | For research use only |
NCBI | NP_443730 |
Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Rabbit Anti-GNB1L Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-GNB1L Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |