You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693593 |
---|---|
Category | Proteins |
Description | Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis. |
CAS Number | 196109-31-6 |
Purity | ≥95% |
MW | 3992.47 |
Formula | C176H272N46O58S |
Target | GCGR |
Protein Sequence | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 95% by HPLC | |
3992.4 Da | |
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |