Exendin-4 (3-39) amide

• Catalog Number: orb1140522
• Category: Proteins
• Description: Glucagon like peptide 1 (GLP-1) receptor antagonist; Peptides.
• CAS Number: 196109-31-6
• Modifications: C terminal amide.
• Structure: H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
• Target Areas: Glucagon and related receptors
• Form/Appearance: Freeze dried solid
• Purity: > 95% by HPLC
• MW: 3992.4 Da
• Formula: C₁₇₆H₂₇₂N₄₆O₅₈S
• Solubility (25°C): Soluble in dilute acid
• Protein Sequence: H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
• Storage: Store desiccated, frozen and in the dark
• Alternative names: 196109-31-6, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
• Background: Exendin-4 (3-39) amide is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.