You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2694980 |
---|---|
Category | Proteins |
Description | Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn. |
CAS Number | 130357-25-4 |
Purity | ≥95% |
MW | 4202.66 |
Formula | C184H282N50O61S1 |
Target | others |
Protein Sequence | HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 95% by HPLC | |
3992.4 Da | |
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |