You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584580 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYP2A6 |
Target | CYP2A6 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYP2A6 |
Protein Sequence | Synthetic peptide located within the following region: MEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRD |
UniProt ID | P11509 |
MW | 56kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CPA6, CYP2A, CYP2A3, P450PB, CYPIIA6, P450C2A |
Note | For research use only |
NCBI | NP_000753 |
WB Suggested Anti-CYP2A6 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Small Intestine.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Primate | |
Rabbit | |
Polyclonal | |
Unconjugated |