You have no items in your shopping cart.
Cart summary
Item 1 of 1
CYP2A6 Rabbit Polyclonal Antibody
Catalog Number: orb584580
| Catalog Number | orb584580 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CYP2A6 |
| Target | CYP2A6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYP2A6 |
| Protein Sequence | Synthetic peptide located within the following region: MEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRD |
| UniProt ID | P11509 |
| MW | 56kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CPA6, CYP2A, CYP2A3, P450PB, CYPIIA6, P450C2A |
| Note | For research use only |
| NCBI | NP_000753 |
WB Suggested Anti-CYP2A6 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Small Intestine.
- Item 1 of 2
CYP2A6 Antibody [orb626189]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg - Item 1 of 1
Anti-Cytochrome P450 2A6 Antibody [orb213819]
WB
Human, Primate
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
