CYP2A6 Rabbit Polyclonal Antibody

• Catalog Number: orb584579
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CYP2A6
• Target: CYP2A6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2A6
• Protein Sequence: Synthetic peptide located within the following region: AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKH
• UniProt ID: P11509
• MW: 56kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CPA6, CYP2A, CYP2A3, P450PB, CYPIIA6, P450C2A
• Note: For research use only
• NCBI: NP_000753

WB Suggested Anti-CYP2A6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: COLO205 cell lysate.