CDK4 Rabbit Polyclonal Antibody

• Catalog Number: orb573611
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDK4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: CDK4
• UniProt ID: P11802
• Protein Sequence: Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• NCBI: NP_000066
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CMM3, PSK-J3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CDK4 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb573611 with 1:200 dilution. Western blot was performed using orb573611 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: CDK4 IP with orb573611 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Lanes: 1. 30 ug human HCT116 cell lysate, 2. 30 ug genotoxic treated human HCT116 cell lysate, 3. 30 ug genotoxic treated human HCT116 cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: CDK4.

Lanes: Lane 1: 30 ug untreated human HCT116 cell lysate, Lane 2-3: 30 ug genotoxic agent treated human HCT116 cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: CDK4, CDK4 is supported by BioGPS gene expression data to be expressed in HCT116.

Rabbit Anti-CDK4 antibody, Catalog Number: orb573611, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CDK4 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.