Cart summary

You have no items in your shopping cart.

Ataxin 1 Antibody (PerCP)

SKU: orb150781
FeaturedFeatured Product

Description

Mouse monoclonal to Ataxin 1 (PerCP). Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons..

Images & Validation

Tested ApplicationsICC, IF, IHC, IP, WB
Dilution rangeWB (1:1000), ICC/IF (1:100)
ReactivityHuman, Mouse, Rat
Application Notes
1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

Key Properties

HostMouse
ClonalityMonoclonal
IsotypeIgG2b
Clone No.N76/8 (Formerly sold as S76-8)
ImmunogenSynthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
TargetAtaxin 1
Molecular Weight85kDa
PurificationProtein G Purified
ConjugationPerCP

Storage & Handling

StorageConjugated antibodies should be stored according to the product label
Buffer/Preservatives95.46mM Phosphate, 2.48mM MES and 2mM EDTA
Concentration1 mg/ml
DisclaimerFor research use only

Alternative Names

Ataxin 1, Ataxin-1, ATX1, Atxn1, D6S504E, OTTHUMP00000016065, SCA1, Spinocerebellar ataxia type 1 protein

Similar Products

  • ATF4 Antibody (PerCP) [orb150637]

    ICC,  IF,  IHC,  WB

    Human, Rat

    Mouse

    Monoclonal

    PerCP

    100 μg
  • Ataxin 1 Antibody (PerCP) [orb151105]

    ICC,  IF,  WB

    Human, Mouse, Rat

    Mouse

    Monoclonal

    PerCP

    100 μg
  • Ataxin 3 Rabbit Polyclonal Antibody (PerCP-Cy5.5) [orb2492133]

    IF

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    PerCP/Cy5.5

    100 μl
  • Ataxin 3 Rabbit Polyclonal Antibody (PerCP) [orb2492134]

    IF

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    PerCP

    100 μl
  • Phospho-Ataxin 1 (Ser775) Rabbit Polyclonal Antibody (PerCP-Cy5.5) [orb2533480]

    IF

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    PerCP/Cy5.5

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Ataxin 1 Antibody (PerCP)

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone N76/8. Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody at 1:100 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) Ataxin 1 Antibody (D) Composite.

Ataxin 1 Antibody (PerCP)

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone N76/8. Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) Ataxin 1 Antibody. (D) Composite.

UniProt Details

No UniProt data available

NCBI Gene Details

No NCBI Gene data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IF
Immunofluorescence
View Protocol
ICC
Immunocytochemistry
View Protocol
IP
Immunoprecipitation
View Protocol

Ataxin 1 Antibody (PerCP) (orb150781)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 660.00
DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry