VIM Rabbit Polyclonal Antibody

• Catalog Number: orb580337
• Category: Antibodies
• Description: Rabbit polyclonal antibody to VIM
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VIM
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: VIM
• UniProt ID: P08670
• Protein Sequence: Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
• NCBI: NP_003371
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FLJ36605
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

Rabbit Anti-VIM Antibody, Catalog Number: orb580337, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: VIM: Red DAPI:Blue, Gene Name: VIM.

The Vimentin antibody orb580337 works well for visualization of the vimentin cytoskeleton. We used PFA-fixed COS-7 cells and an antibody dilution of 1:400.

WB Suggested Anti-VIM Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.