You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2008487 |
---|---|
Category | Proteins |
Description | USP38 Peptide - middle region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | LVNKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEK |
UniProt ID | Q8NB14 |
MW | 116kDa |
Tested applications | WB |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | FLJ35970, HP43.8KD, KIAA1891 |
Note | For research use only |
NCBI | NP_115946 |