Cart summary

You have no items in your shopping cart.

USP36 Peptide - N-terminal region

USP36 Peptide - N-terminal region

Catalog Number: orb2004099

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2004099
CategoryProteins
DescriptionUSP36 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: KLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEA
UniProt IDQ8IXW9
MW31kDa
Tested applicationsWB
Application notesThis is a synthetic peptide designed for use in combination with USP36 Rabbit Polyclonal Antibody (orb583656). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
NoteFor research use only