You have no items in your shopping cart.
Cart summary
USP35 Peptide - C-terminal region
Catalog Number: orb2008490
| Catalog Number | orb2008490 |
|---|---|
| Category | Proteins |
| Description | USP35 Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | MEAISKDNILYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSP |
| UniProt ID | Q9P2H5 |
| MW | 113kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_065849 |
